INFORMATION:   Human TIGIT (T cell immunoreceptor with Ig and ITIM domains) is a coinhibitory receptor expressed by activated T cells, memory T cells, Treg cells and NK cells.  It binds to CD155(PVR) and less avidly to CD112(PVRL2). 

Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human TIGIT fused  to murine IgG2a Fc.

Residual  signal peptide amino acids (7aa): kpqapel

Mature TIGIT(EC) (118aa): (22)mmtgtiettgnisaekggsiilqchlssttaqvtqvnweqqdqllaicnadlgwhispsfkdrvapgpglgltlqsltvndtgeyfciyhtypdgtytgriflevlessvaehgarfq(139)

Linking amino acids (2aa):  fq

Murine IgG2aFc (233aa):  eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Predicted nonglycosylated monomeric weight: 40 kd.  TIGIT-muIg  runs as a dimer in  SDS-PAGE with a molecular weight of approximately 100 kD.

Transfectant Cell Line:  CHO                           

References: 1)  Dougall WC, AC Anderson, et al. (2017) Immunol Rev 276(1): 112-120. doi: 10.1111/imr.12518.  PMID: 28258695.

USD $300.00

In cart: 0
= $300.00
Catalog #: 556-020
Form: Pur/WA
Size: 25 µg
Alternate Name: WUCAM, Vstm3
Applications: FC, EIA


Other Forms