INFORMATION:  Human CD304 (neuropilin, NRP, NP1, BDCA-4) is a 140 kD type I glycoprotein expressed by a variety of tissue types,including Treg, follicular TH, neurons, Dendritic cells, and Endothelial cells. Its ligands include VEGF165 and Semaphorin family members. It is a reliable marker for human BCP-ALL1. Soluble CD304 has been used to slow progression of murine AML 2.     CD304-muIg runs as a dimer in SDS-PAGE with a molecular weight of approximately 200 kD.

Molecular Structure: A soluble molecule consisting of the extracellular domain of mature human CD304 fused to murine IgG2a Fc.

Residual signal peptide amino acids (6aa): kpqape

Mature CD304(EC) (623aa): (22)frndkcgdtikiespgyltspgyphsyhpsekcewliqapdpyqriminfnphfdledrdckydyvevfdgenenghfrgkfcgkiapppvvssgpflfikfvsdyethgagfsiryeifkrgpecsqnyttpsgvikspgfpekypnslectyivfvpkmseiilefesfdlepdsnppggmfcrydrleiwdgfpdvgphigrycgqktpgrirsssgilsmvfytdsaiakegfsanysvlqssvsedfkcmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdlgllrfvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdvvvavfpkplitrfvrikpatwetgismrfevygckitdypcsgmlgmvsglisdsqitssnqgdrnwmpenirlvtsrsgwalppaphsyinewlqidlgeekivrgiiiqggkhrenkvfmrkfkigysnngsdwkmimddskrkaksfegnnnydtpelrtfpalstrfiriyperathgglglrmellgceveaptagpttpngnlvdecdddqanchsgtgddfqltggttvlatekptvidstiqsefp(644)

Murine IgG2aFc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk

Predicted nonglycosylated monomeric weight: 97 kd.

Functional Application: Recombinant CD304-muIg binds to immobilized VEGF165 in EIA.

Transfectant Cell Line:  HEK

References:

1) Pratyusha Gudapati Prashant R Tembhare , et al. (2020 Jul) Cytometry B Clin Cytom. 98(4):328-335. doi: 10.1002/cyto.b.21866. Epub 2020 Jan 16.

2) Gagnon ML, Klagsbrun M, et al. (March 2000). ” Proceedings of the National Academy of Sciences of the United States of America. 97 (6): 2573–8. Bibcode:2000PNAS…97.2573G. doi:10.1073/pnas.040337597. PMC 15970. PMID 10688880.

USD $300.00

In cart: 0
= $300.00
Catalog #: 557-020
Form: Pur/WA
Size: 25 µg
Alternate Name: neuropilin, NRP, NP1, BDCA-4
Applications: EIA

Downloads

Other Forms