A soluble fusion protein consisting of the

Mature extracellular region of  CD273EC: (20)lftvtvpkelyiiehgsnvtlecnfdtgshvnlgaitaslqkvendtsphreratlleeqlplgkasfhipqvqvrdegqyqciiiygvawdykyltlkvkasyrkinthilkvpetdeveltcqatgyplaevswpnvsvpantshsrtpeglyqvtsvlrlkpppgrnfscvfwnthvreltlasidlqsqmeprthpt(220)

Linker +Murine IgG2a Hinge + Fc : (221)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtvtcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklgvekknwvernsyscsvvheglhnhhttksfsrtpg(455)

Predicted monomeric (non glycosylated) molecular weight: 49 kd. The molecule is dimeric and runs at ~135 kd in SDS-PAGE under native conditions, and ~74 kd reduced

Transfectant Cell Line: CHO                    

INFORMATION: CD273 (B7-DC, PCDL-2, Programmed cell death ligand 2, Butyrophilin-like protein) is a type I surface molecule with homology to CD80, CD86, CD274.  It is expressed primarily by Dendritic cells.and provides a stimulatory signal to CD279 (PD-1, Programmed Death molecule) which serves an important immunoregulatory role by down regulating T cell response.  CD273 binds to CD279(PD-1) with a 2- 6 fold higher affinity than CD274(2).

Recombinant CD273-muIg binds to recombinant CD279 in EIA.

References:

1) E N Rozali, W J Lesterhuis, et al. (2012) Clin Develop Immunol 2012: 656340. 

2) P Youngnak, H Konozo, et al. (2003) Biochemical and Biophysical Research Communications 307(3): 672-677.

USD $375.00

In cart: 0
= $375.00
Catalog #: 573-030
Form: Biotin
Size: 25µg
Alternate Name: B7-DC, PD-L2, Programmed Death Ligand 2, Butyrophilin-like protein

Downloads

Other Forms