CD274 (B7-H1, PD-L1, Programmed Death Ligand) is a member of the B7 family and is expressed on a variety of tissues including lymphoid cells.  It plays an important role in regulation of T cell activation, and is involved in progression of cancer, arthritis and HIV infection (3).  CD274 binding to its receptor CD279 (PD-1) on activated T cells can decrease proliferation.  Conversely, ligation of CD279 on primed T cells can stimulate IL-10 production.  High levels of CD274 present in Renal cell carcinoma are associated with poor prognosis (1).  Tumor expressed CD274 can increase apoptosis of tumor specific T cells resulting in better tumor cell survival (2).  Gamma Interferon and PHA can up regulate CD274 expression on T cells.

Molecular Structure:   A soluble fusion protein consisting of the murine CD8 alpha leader sequence, the mature extracellular (224aa) domain of human CD274 fused to murine IgG2a Fc + hinge (233aa).

muCD8 apha signal peptide residual amino acids+ linker: (1) kpqapelrgsas

CD274 mature EC:  (224aa): (13)ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr

Linker +Murine IgG2a Hinge + Fc (235 aa): (237)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(471)

Predicted monomeric (non glycosylated) molecular weight: 54.4 kd. The molecule is dimeric and runs at about 120 kd in SDS-PAGE under native conditions.

Transfectant Cell Line:  CHO

References:

1) Cancer Research (April 2006) 66:3381.

2) J Molecular Medicine (Feb 2004) 81(5):281. 

3) Int J Hematol (Nov 2003) 78(4):321.

USD $375.00

In cart: 0
= $375.00
Catalog #: 541-030
Form: Biotin
Size: 25 µg
Alternate Name: CD274, B7H1, B7-H1, PDram Death Ligand-L1, Prog
Applications: EIA

Downloads

Other Forms