Human CD70 (TNFSF7) is the ligand for CD27 (TNFRSF7) and is notably absent on resting lymphocytes. CD70 is expressed after activation on about 20% of T cells and on about 70% of B cells. Recombinant CD70-muCD8 binds to cell surface CD27 on human peripheral blood leukocytes. Recombinant CD70 constructs have been used to elicit  T cell responses in vitro(6) and in vivo (5).

Molecular Structure:  A soluble molecule consisting of the extracellular domain (167aa) of murine CD8 alpha fused to 146 (c-term) amino acids of the extracellular domain of human CD70, with a predicted monomeric weight of 34.8 kd.  

Sequence for extracellular mature murine CD8alpha: (28) kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvnstttkpvlrtpspvhptgtsqpqrpedcrprgsvkgtgldfacd(194);

Linking amino acids:  gt   ;

extracellular human CD70: (48) lpleslgwdvaelqlnhtgpqqdprlywqggpalgrsflhgpeldkgqlrihrdgiymvhiqvtlaicssttasrhhpttlavgicspasrsisllrlsfhqgctivsqrltplargdtlctnltgtllpsrntdetffgvqwvrp(193).

Transfectant Cell Line:  CHO

Functional Application:  CD70-muCD8 binds to cell surface CD27 on  a subset of T cells

References: 

1) R.Q. Hintzen, et al, (1994) J Immunol 152: 1762-1773. 

2) M.R. Bowman, et al, (1994) J Immunol 152: 1756-1761.

3) Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 1137-1138.

4) K. Agematsu, et al, (1995) J Immunol 154: 3627-3635.

5) T. F. Rowley , A Al-Shamkhani, (2004) J Immunol 172: 6039-6046.

6) J. M.Carr, D. T. Fearon, et al. (2006) PNAS:103(51):19454-19459

USD $300.00

In cart: 0
= $300.00
Catalog #: 537-820
Form: Pur/PF
Size: 25 µg
Alternate Name: Ki-24
Applications: FC, EIA

Downloads

Other Forms