Human CD134 (OX40) (ACT35) is an activation-associated antigen which is predominantly expressed on activated CD4 positive cells.  CD134 antigen is a member of the tumor necrosis factor (TNF) receptor family of molecules and may be involved with regulating T cell-dependent B cell proliferation and differentiation (2).

Molecular Structure:  A soluble fusion protein consisting of the extracellular (177 aa) domain of  mature extracellular human CD134 fused to murine IgG2a Fc (232 aa), with a predicted monomeric molecular weight of 45.6 kd.

CD134 (mature EC): (29)lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr(205)

+linker: gt

fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg

Predicted monomeric molecular weight of 45.6 kd.  Fusion construct is dimeric and runs at about 105 kd in non reduced SDS-PAGE.

Transfectant Cell Line:  CHO

Functional Application:  CD134-muIg fusion protein blocks binding of anti-human CD134 Ab and Recombinant CD252-muCD8 to human tumor cells.

References: 

1.   U. Latza, et al, (1994) Eur J Immunol  24: 677-683. 

2.  E. Stuber, et al, (1995) Immunity  2: 507-521. 

3.    Leukocyte Typing IV (W. Knapp, et al, eds.) Oxford University Press, Oxford, (1989) p. 464-465. 

4.   Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford, (1995) p. 1157-1160.

5. Nature Structural & Molecular Biology  12, 60 - 66 (2004) 

USD $300.00

In cart: 0
= $300.00
Catalog #: 513-020
Form: Pur/WA
Size: 25 µg
Alternate Name: OX40, ACT35
Applications: FC, EIA

Downloads

Other Forms