Human CD40 is a member of the tumor necrosis factor (TNF) receptor family and is present on all B cells except plasma cells.  CD40 is also found on some epithelial cells, carcinomas and lymphoid dendritic cells.  CD40 plays an important role in B cell activation and the interaction with its ligand CD154 (CD40 Ligand) is essential for isotype switching (1).

Molecular Structure:  A soluble fusion protein consisting of the mature extracellular (173aa) domain of human CD40: epptacrekqylinsqccslcqpgqklvsdctefteteclpcgesefldtwnrethchqhkycdpnlglrvqqkgtsetdtictceegwhctseacescvlhrscspgfgvkqiatgvsdticepcpvgffsnvssafekchpwtscetkdlvvqqagtnktdvvcgpqdrlr

+linker: gt

fused to murine IgG2a Fc (233aa): eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg

Predicted monomeric molecular weight of 45.6 kd.

Transfectant Cell Line: CHO

Functional Application: CD40-muIg fusion protein blocks binding of anti-human CD40 to Raji human tumor cells.

References:

1.  T.A. Foy, et al, (1996) Annu Rev Immunol  14: 591-617.

2.  M.E. Ozaki, et al, (1997) J Immunol  159: 214-221

USD $300.00

In cart: 0
= $300.00
Catalog #: 504-820
Form: Pur/PF
Size: 25 µg
Alternate Name: TNFRSF5
Applications: FC, EIA

Downloads

Other Forms