Human CD137L (4-1BB Ligand) is a type II transmembrane protein constitutively expressed by monocytes, B cells and neuroblastoma cells (1).  Binding of CD137 (4-1BB) to CD137L induces monocyte activation (2).

Molecular Structure: A soluble molecule consisting of the extracellular domain of murine CD8 alpha(167aa): kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvnstttkpvlrtpspvhptgtsqpqrpedcrprgsvkgtgldfacd

Linking amino acids:   gt

Fused to the extracellular domain of human CD137L (184aa):  regpelspddpaglldlrqgmfaqlvaqnvllidgplswysdpglagvsltgglsykedtkelvvakagvyyvffqlelrrvvagegsgsvslalhlqplrsaagaaalaltvdlppassearnsafgfqgrllhlsagqrlgvhlhteararhawqltqgatvlglfrvtpeipaglpsprse

Predicted non glycosylated monomeric molecular weight:  38.2 kd.

Transfectant Cell Line: CHO

Functional Application: Human CD137L-muCD8 binds to CD137 in FACS (3) and EIA(4).  It  blocks binding of anti-CD137 monoclonal antibody (clone 4B4-1)  to CD137 expressing cells in FACS. Immobilzed CD137L can induce cytokine expression (IL-4, IL-10, IL-13) by CD137 expressing T cells (5).

References:

1.   M.R. Alderson, et al, (1994) Eur J Immunol  24: 2219-2227.

2.   J. Langstein, et al, (1998) J Immunol  160: 2488-2494.

3.  W.Lin,  S.E. Strome, et al. (2008) Blood 112: 699-707.  PMID 18519814

4.  M Cho, J Myoung (Dec 2015) J General Virology 96(12): 3635-3645. PMID 26467721

5.  Alfaro C, Melero I, et al. (2015) OncoImmunology 4(12): e1054597.  doi: 10.1080/2162402X.2015.1054597.

USD $300.00

In cart: 0
= $300.00
Catalog #: 503-020
Form: Pur/WA
Size: 25 µg
Alternate Name: 4-1BBL
Applications: FC, EIA

Downloads

Other Forms